- KIAA1704 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-89252
- KIAA1704
- 0.1 ml (also 25ul)
- AD029, KIAA1704, LSR7, bA245H20.2
- Human
- Immunohistochemistry, Immunohistochemistry-Paraffin
- This antibody was developed against Recombinant Protein corresponding to amino acids: KLTKGDDDSS KPIVRESWMT ELPPEMKDFG LGPRTFKRRA DDTSGDRSIW TDTPADRERK AKETQEARKS SSKKDEEHIL SGRD
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- GPALPP motifs containing 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
KLTKGDDDSSKPIVRESWMTELPPEMKDFGLGPRTFKRRADDTSGDRSIWTDTPADRERKAKETQEARKSSSKKDEEHILSGRD
Specifications/Features
Available conjugates: Unconjugated